anti-Humain RALGDS anticorps pour Immunohistochemistry

Recommended RALGDS Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Ral Guanine Nucleotide Dissociation Stimulator (RALGDS) Anticorps
  • RGDS
  • RGF
  • RalGEF
  • Gnds
  • Rgds
  • mKIAA1308
  • RALGDS
  • ral guanine nucleotide dissociation stimulator
  • RALGDS
  • Ralgds
  • ralgds
Reactivité
Humain
37
3
3
2
2
1
1
Hôte
Lapin
30
7
Clonalité
Polyclonal
Conjugué
Cet anticorp RALGDS est non-conjugé
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
32
21
2
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4349262
Produit non disponible pour cette région.

General

Antigène Ral Guanine Nucleotide Dissociation Stimulator (RALGDS) Anticorps
Reactivité Humain
(37), (3), (3), (2), (2), (1), (1)
Hôte Lapin
(30), (7)
Clonalité
Polyclonal
Conjugué Cet anticorp RALGDS est non-conjugé
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(32), (21), (2), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-RALGDS anticorps

Détail du antigène RALGDS Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: CNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSS
Isotype IgG
Plasmids, Primers & others

Détail du antigène RALGDS

Détail du produit anti-RALGDS anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation RALGDS (RALGDS Antibody Extrait)
Sujet Gene Symbol: RALGDS
ID gène 5900
UniProt Q12967
Pathways Neurotrophin Signaling Pathway

Information d'application

Détail du produit anti-RALGDS anticorps Détail du antigène RALGDS Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-RALGDS anticorps Détail du antigène RALGDS Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-RALGDS anticorps Détail du antigène RALGDS Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Ral Guanine Nucleotide Dissociation Stimulator (RALGDS) antibody (ABIN4349262) Immunocytochemistry/Immunofluorescence: RALGDS Antibody [NBP2-30584] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Ral Guanine Nucleotide Dissociation Stimulator (RALGDS) antibody (ABIN4349262) Immunohistochemistry: RALGDS Antibody [NBP2-30584] - Immunohistochemical staining of ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ral Guanine Nucleotide Dissociation Stimulator (RALGDS) antibody (ABIN4349262) Immunohistochemistry-Paraffin: RALGDS Antibody - Staining of human kidney shows mode...