anti-Rat (Rattus) BRK1 anticorps pour Immunohistochemistry

Recommended BRK1 Antibody

BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Anticorps
  • brk1
  • C22H3orf10
  • brick1
  • c3orf10
  • C3orf10
  • MDS027
  • hHBrk1
  • 6720456B07Rik
  • AW011779
  • ATBRK1
  • BRICK1
  • HSPC300
  • T9I22.8
  • T9I22_8
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit
  • BRICK1, SCAR/WAVE actin nucleating complex subunit
  • brick 1
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog
  • BRICK1
  • brk1
  • BRK1
  • Brk1
  • brk1.S
Middle Region
Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
Cet anticorp BRK1 est non-conjugé
Immunohistochemistry (IHC), Western Blotting (WB)


N° du produit ABIN629872
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
13.109466 ABIN2784463 IHC WB Rabbit Middle Region Polyclonal 0
13.109466 ABIN2434746 IHC ELISA WB Rabbit IgG Polyclonal 0
10.109466 ABIN2433121 IHC ELISA Rabbit IgG Polyclonal 0
7 ABIN341474 IHC IHC (p) WB Rabbit IgG C-Term Polyclonal 0
4 ABIN2463416 IHC ELISA WB Rabbit Polyclonal 0
1 ABIN5704240 ELISA IHC Rabbit IgG Polyclonal 0
1 ABIN5931087 ELISA IHC Rabbit IgG Polyclonal 0


Antigène BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Anticorps
Épitope Middle Region
(1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
(36), (31), (22), (3), (3), (2), (2), (2), (1), (1)
Hôte Lapin
(32), (4)
Conjugué Cet anticorp BRK1 est non-conjugé
(2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(13), (13), (11), (9), (5)

Détail du produit anti-BRK1 anticorps

Détail du antigène BRK1 Information d'application Stockage Images
Specificité C3 ORF10 antibody was raised against the middle region of C3 rf10
Purification Purified
Immunogène C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Plasmids, Primers & others

Détail du antigène BRK1

Détail du produit anti-BRK1 anticorps Information d'application Stockage Images Haut de la page
Autre désignation C3ORF10 (BRK1 Antibody Extrait)
Sujet C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Poids moléculaire 9 kDa (MW of target protein)
Pathways Signalisation RTK

Information d'application

Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Stockage Images Haut de la page
Indications d'application WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions For Research Use only


Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to...
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. M...
Western Blotting (WB) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody used at 2.5 ug/ml to detect target protein.