anti-Humain Complement Factor B anticorps pour Immunohistochemistry

Recommended Complement Factor B Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Complement Factor B (CFB) Anticorps
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • bf/c2
  • CFB
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • complement factor B S homeolog
  • complement factor B L homeolog
  • CFB
  • cfb
  • bf
  • cfb.S
  • cfb.L
  • bf/c2
  • LOC100555981
  • Cfb
Reactivité
Humain
204
48
45
2
1
1
1
1
1
Hôte
Lapin
127
88
14
6
Clonalité
Polyclonal
Conjugué
Cet anticorp Complement Factor B est non-conjugé
23
19
11
4
4
3
3
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
167
152
52
29
24
16
13
13
12
10
9
6
6
4
3
2
2
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4299963
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.907254 ABIN1871801 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
8.907254 ABIN3015550 IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN4299962 IHC IHC (p) SimWes WB Rabbit IgG Connectez-vous pour afficher Polyclonal 4
1 ABIN1858372 ICC IHC WB Rabbit IgG AA 35-160 Connectez-vous pour afficher Polyclonal 0
1 ABIN4299964 IHC IHC (p) WB Rabbit IgG Center Connectez-vous pour afficher Polyclonal 0
1 ABIN1175357 ICC IHC WB Rabbit IgG AA 270-388 Connectez-vous pour afficher Polyclonal 0
1 ABIN1858375 ICC IHC WB Rabbit IgG AA 477-600 Connectez-vous pour afficher Polyclonal 0
1 ABIN255394 Func FACS IHC (fro) IHC ELISA WB Mouse IgG1 Connectez-vous pour afficher 014III-33-2-4-3 0
1 ABIN255392 FACS IHC (fro) IHC ELISA WB Mouse IgG1 Connectez-vous pour afficher 10-Sep 0
1 ABIN268111 IHC (p) IHC Sheep Connectez-vous pour afficher Polyclonal 0
1 ABIN2232229 FACS IHC ELISA WB Rabbit IgG AA 469-494, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2879874 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2232233 FACS IHC ELISA WB FITC Rabbit IgG AA 469-494, Center, Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN4299961 IHC IHC (p) SimWes WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1814259 FACS IHC Rabbit AA 469-494 Connectez-vous pour afficher Polyclonal 0
1 ABIN2887070 IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN2237112 FACS IHC ELISA WB Mouse IgG1 Connectez-vous pour afficher 10B2566 0
1 ABIN2237110 FACS IHC ELISA WB Mouse IgG1 Connectez-vous pour afficher 10B2567 0
1 ABIN2695201 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2263851 IHC ELISA WB Goat IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Complement Factor B (CFB) Anticorps
Reactivité Humain
(204), (48), (45), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(127), (88), (14), (6)
Clonalité
Polyclonal
Conjugué Cet anticorp Complement Factor B est non-conjugé
(23), (19), (11), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(167), (152), (52), (29), (24), (16), (13), (13), (12), (10), (9), (6), (6), (4), (3), (2), (2), (1)
Pubmed 2 références disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-Complement Factor B anticorps

Détail du antigène Complement Factor B Information d'application Stockage References for anti-Complement Factor B antibody (ABIN4299963) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Isotype IgG

Détail du antigène Complement Factor B

Détail du produit anti-Complement Factor B anticorps Information d'application Stockage References for anti-Complement Factor B antibody (ABIN4299963) Images Haut de la page
Antigène
Autre désignation Complement Factor B (CFB Antibody Extrait)
Sujet Gene Symbol: CFB
ID gène 629
Pathways Système du Complément, Proton Transport, Ribonucleoside Biosynthetic Process

Information d'application

Détail du produit anti-Complement Factor B anticorps Détail du antigène Complement Factor B Stockage References for anti-Complement Factor B antibody (ABIN4299963) Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-Complement Factor B anticorps Détail du antigène Complement Factor B Information d'application References for anti-Complement Factor B antibody (ABIN4299963) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Complement Factor B antibody (ABIN4299963)

Détail du produit anti-Complement Factor B anticorps Détail du antigène Complement Factor B Information d'application Stockage Images Haut de la page
Produit citée dans:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." dans: Proteome science, Vol. 9, pp. 73, 2011

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." dans: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009

Images

Détail du produit anti-Complement Factor B anticorps Détail du antigène Complement Factor B Information d'application Stockage References for anti-Complement Factor B antibody (ABIN4299963) Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Complement Factor B (CFB) antibody (ABIN4299963) Immunohistochemistry: Complement Factor B Antibody [NBP1-89986] - Staining of human p...