IL21 Receptor anticorps (AA 35-65)

N° du produit ABIN1819422

Détail du produit anti-IL21 Receptor anticorps

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Épitope: AA 35-65

Reactivité: Humain, Singe

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp IL21 Receptor est non-conjugé

Application: ELISA, Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificité: Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.

Purification: Affinity purified

Immunogène: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%), Chimpanzee, Gibbon (97%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Information d'application

Indications d'application: Approved: ELISA (1:50000), IHC, IHC-P (1:150)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur IL21 Receptor

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Autre désignation: IL21 Receptor / IL21R (IL21R Produits)

Synonymes: anticorps IL21R, anticorps il-21ra.a, anticorps CD360, anticorps NILR, anticorps interleukin 21 receptor, anticorps interleukin 21 receptor, tandem duplicate 1, anticorps IL21R, anticorps il21r.1, anticorps Il21r

Sujet: Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor

ID gène: 50615

UniProt: Q9HBE5

Pathways: Signalistation JAK/STAT