ATP2A2 anticorps (N-Term)

N° du produit ABIN3030067

Détail du produit anti-ATP2A2 anticorps

Antigène: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP2A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ATP2A2

Antigène: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Autre désignation: ATP2A2 (ATP2A2 Produits)

Synonymes: anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps ATP2A2, anticorps ATP2B, anticorps DAR, anticorps DD, anticorps SERCA2, anticorps SERCA2A, anticorps ATP2, anticorps Serca2, anticorps SercaII, anticorps 9530097L16Rik, anticorps D5Wsu150e, anticorps SERCA2B, anticorps mKIAA4195, anticorps atp2a2, anticorps zgc:55380, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a, anticorps atp2a1.S, anticorps ATP2A2, anticorps Atp2a2, anticorps atp2a2a

Sujet: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

ID gène: 488

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process