SCARB1 anticorps (C-Term)

N° du produit ABIN3043322

Détail du produit anti-SCARB1 anticorps

Antigène: SCARB1 (Scavenger Receptor Class B, Member 1 (SCARB1))

Épitope: AA 478-509, C-Term

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCARB1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse,Rat.

Séquence: KKGSQDKEAI QAYSESLMSP AAKGTVLQEA KL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse,Rat.
Gene Name: scavenger receptor class B, member 1
Protein Name: Scavenger receptor class B member 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SCARB1

Antigène: SCARB1 (Scavenger Receptor Class B, Member 1 (SCARB1))

Autre désignation: SCARB1 (SCARB1 Produits)

Synonymes: anticorps cb1015, anticorps SCARB1, anticorps Scarb1, anticorps CD36L1, anticorps CLA-1, anticorps CLA1, anticorps HDLQTL6, anticorps SR-BI, anticorps SRB1, anticorps AI120173, anticorps CD36, anticorps Cd36l1, anticorps Cla-1, anticorps Cla1, anticorps D5Ertd460e, anticorps Hdlq1, anticorps Hlb398, anticorps SR-B1, anticorps SRBI, anticorps Srb1, anticorps mSR-BI, anticorps scavenger receptor class B, member 1, anticorps scavenger receptor class B member 1, anticorps scarb1, anticorps SCARB1, anticorps Scarb1, anticorps CpipJ_CPIJ014332, anticorps CpipJ_CPIJ019101

Sujet: Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.

Synonyms: CD36 AND LIMPII ANALOGOUS 1 antibody|CD36 antibody|CD36 Antigen like 1 antibody|CD36 antigen-like 1 antibody|CD36L1 antibody|CLA 1 antibody|CLA-1 antibody|CLA1 antibody| Collagen type I receptor antibody|HDLQTL6 antibody|MGC138242 antibody|SCARB1 antibody| Scavebger Receptor Class B Member 1 antibody|Scavenger receptor class B member 1 antibody| Scavenger Receptor Class B Type 1 antibody|SCRB1_HUMAN antibody|SR BI antibody|SR-BI antibody|SRB1 antibody|SRBI antibody|Thrombospondin receptor like 1 antibody|thrombospondin receptor-like 1 antibody

ID gène: 20778

UniProt: Q61009

Pathways: Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Lipid Metabolism, SARS-CoV-2 Protein Interactome