RAB14 anticorps (C-Term)

N° du produit ABIN3043364

Détail du produit anti-RAB14 anticorps

Antigène: RAB14 (RAB14, Member RAS Oncogene Family (RAB14))

Épitope: AA 124-153, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB14 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.

Séquence: NKADLEAQRD VTYEEAKQFA EENGLLFLEA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.
Gene Name: RAB14, member RAS oncogene family
Protein Name: Ras-related protein Rab-14

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur RAB14

Antigène: RAB14 (RAB14, Member RAS Oncogene Family (RAB14))

Autre désignation: RAB14 (RAB14 Produits)

Synonymes: anticorps FBP, anticorps RAB-14, anticorps 0610030G24Rik, anticorps 2810475J17Rik, anticorps A830021G03Rik, anticorps AI314285, anticorps AI649155, anticorps D030017L14Rik, anticorps cb731, anticorps fc26g11, anticorps fj47f07, anticorps fj68a01, anticorps wu:fc26g11, anticorps wu:fj47f07, anticorps wu:fj68a01, anticorps fbp, anticorps rab-14, anticorps MGC79630, anticorps MGC80680, anticorps RAB14, anticorps RAB14, member RAS oncogene family, anticorps RAB14, member RAS oncogene family S homeolog, anticorps RAB14, anticorps Rab14, anticorps rab14, anticorps rab14.S

Sujet: Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.

Synonyms: bA165P4.3 antibody|F protein binding protein 1 antibody|FBP antibody|GTPase Rab14 antibody|RAB 14 antibody|RAB14 antibody|RAB14 member RAS oncogene family antibody|RAB14_HUMAN antibody|Ras related protein Rab 14 antibody|Ras-related protein Rab-14 antibody|RP11 165P4.4 antibody|Small GTP binding protein RAB14 antibody

ID gène: 51552

UniProt: P61106

Pathways: Asymmetric Protein Localization, SARS-CoV-2 Protein Interactome