RBX1 anticorps (C-Term)

N° du produit ABIN3043566

Détail du produit anti-RBX1 anticorps

Antigène: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Épitope: AA 76-108, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBX1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: NHAFHFHCIS RWLKTRQVCP LDNREWEFQK YGH

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ring-box 1, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase RBX1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ROC1 (76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur RBX1

Antigène: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Autre désignation: RBX1 (RBX1 Produits)

Synonymes: anticorps BA554C12.1, anticorps RNF75, anticorps ROC1, anticorps 1500002P15Rik, anticorps AA517855, anticorps im:7137515, anticorps zgc:136444, anticorps RBX1, anticorps ATRBX1, anticorps F7C8.160, anticorps F7C8_160, anticorps HRT1, anticorps REGULATOR OF CULLINS-1, anticorps RING-BOX 1, anticorps RING-box 1, anticorps hop21, anticorps BEST:CK01110, anticorps CG16982, anticorps CK01110, anticorps Dmel\CG16982, anticorps EG:115C2.11, anticorps Rbx1, anticorps Rbx1/Roc, anticorps Roc, anticorps Roc1alpha, anticorps anon-EST:Posey65, anticorps dRbx1, anticorps dRoc1, anticorps dRoc1a, anticorps ring-box 1, anticorps ring-box 1, E3 ubiquitin protein ligase, anticorps RING-box 1, anticorps RING-box protein 1, anticorps RING-box protein 1a, anticorps Regulator of cullins 1a, anticorps RBX1, anticorps Rbx1, anticorps rbx1, anticorps MGG_08844, anticorps LOC9308017, anticorps rbx-1, anticorps Roc1a

Sujet: RING-box protein 1, also known as ROC1, is a protein that in humans is encoded by the RBX1 gene. This gene is mapped to chromosome 22q13.2 based on an alignment of the RBX1 sequence with the genomic sequence. ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS). SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, E1, and CDC34. Conclusively, ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization.

Synonyms: BA554C12.1 antibody|E3 ubiquitin-protein ligase RBX1 antibody|FLJ60363 antibody|MGC13357 antibody|MGC1481 antibody|OTTHUMP00000028983 antibody|Protein ZYP antibody|Rbx 1 antibody|Rbx1 antibody|RBX1_HUMAN antibody|Regulator of cullins 1 antibody|Ring box 1 antibody| Ring box 1 E3 ubiquitin protein ligase antibody|RING box protein 1 antibody|RING finger protein 75 antibody|RING finger protein antibody|RING-box protein 1 antibody|Ringbox protein 1 antibody|RNF 75 antibody|RNF75 antibody|ROC 1 antibody|ZYP protein antibody

ID gène: 9978

UniProt: P62877

Pathways: Cycle Cellulaire, M Phase, SARS-CoV-2 Protein Interactome