Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

NME1 anticorps (N-Term)

NME1 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043572
  • Antigène Voir toutes NME1 Anticorps
    NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))
    Épitope
    • 16
    • 13
    • 10
    • 8
    • 7
    • 6
    • 6
    • 6
    • 6
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 26-58, N-Term
    Reactivité
    • 106
    • 37
    • 34
    • 6
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 86
    • 19
    • 2
    • 1
    Lapin
    Clonalité
    • 88
    • 19
    Polyclonal
    Conjugué
    • 64
    • 8
    • 7
    • 7
    • 6
    • 5
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp NME1 est non-conjugé
    Application
    • 98
    • 56
    • 28
    • 20
    • 16
    • 13
    • 13
    • 13
    • 7
    • 7
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.
    Séquence
    KRFEQKGFRL VGLKFMQASE DLLKEHYVDL KDR
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: NME/NM23 nucleoside diphosphate kinase 1
    Protein Name: Nucleoside diphosphate kinase A
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product NME1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jin, Dai: "Mutation of the nm23-H1 gene has a non-dominant role in colorectal adenocarcinoma." dans: Molecular and clinical oncology, Vol. 5, Issue 1, pp. 107-110, (2016) (PubMed).

  • Antigène
    NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))
    Autre désignation
    NME1 (NME1 Produits)
    Synonymes
    anticorps AWD, anticorps GAAD, anticorps NB, anticorps NBS, anticorps NDKA, anticorps NDPK-A, anticorps NDPKA, anticorps NM23, anticorps NM23-H1, anticorps AL024257, anticorps NM23-M1, anticorps NM23A, anticorps NDPK-Z1, anticorps NM23-B, anticorps NM23-Z1, anticorps ndpkz1, anticorps nm23b, anticorps nme1, anticorps nme2, anticorps nme2b1, anticorps NME1, anticorps NME1-NME2, anticorps NM23-C1, anticorps ndpk-b, anticorps ndpkb, anticorps nm23-h2, anticorps nm23ndk, anticorps puf, anticorps NBR-A, anticorps NBR-B, anticorps NME1-1, anticorps nm23ndk-a, anticorps NDK I, anticorps NDPK I, anticorps T30A10.80, anticorps T30A10_80, anticorps NDP kinase I, anticorps NME/NM23 nucleoside diphosphate kinase 1, anticorps NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 1, anticorps non-metastatic cells 1, protein (NM23A) expressed in, anticorps NME/NM23 nucleoside diphosphate kinase 2 S homeolog, anticorps NME/NM23 nucleoside diphosphate kinase 2 L homeolog, anticorps nucleoside diphosphate kinase, anticorps nucleoside diphosphate kinase 1, anticorps NME1, anticorps Nme1, anticorps nme2b.1, anticorps nme2.S, anticorps nme2.L, anticorps LOC547870, anticorps NDPK1, anticorps LOC107790563
    Sujet
    NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.

    Synonyms: AWD antibody|AWD, drosophila, homolog of antibody|GAAD antibody|Granzyme A activated DNase antibody|Granzyme A-activated DNase antibody|GZMA activated DNase antibody|Metastasis inhibition factor NM23 antibody|NB antibody|NBS antibody|NDK A antibody|NDKA antibody|NDKA_HUMAN antibody|NDP kinase A antibody|NDPK-A antibody|NDPKA antibody|NM23 antibody|NM23 long variant, included antibody|nm23-H1 antibody|NM23-M1 antibody|NM23H1B, included antibody|NME/NM23 nucleoside diphosphate kinase 1 antibody|Nme1 antibody|NME1-NME2 spliced read-through transcript, included antibody|Non-metastatic cells 1, protein (NM23A) expressed in antibody| Nonmetastatic cells 1, protein expressed in antibody|Nonmetastatic protein 23 antibody|Nonmetastatic protein 23, homolog 1 antibody| Nucleoside diphosphate kinase A antibody|Tumor metastatic process-associated protein antibody
    ID gène
    4830
    UniProt
    P15531
    Pathways
    Apoptose, Nucleotide Phosphorylation, Carbohydrate Homeostasis, Ribonucleoside Biosynthetic Process
Vous êtes ici:
Support technique