PCSK6 anticorps (C-Term)

N° du produit ABIN3043593

Détail du produit anti-PCSK6 anticorps

Antigène: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Épitope: AA 614-651, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCSK6 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.

Séquence: RNPEKQGKLK EWSLILYGTA EHPYHTFSAH QSRSRMLE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.
Gene Name: proprotein convertase subtilisin/kexin type 6
Protein Name: Proprotein convertase subtilisin/kexin type 6

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PCSK6

Antigène: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Autre désignation: PCSK6 (PCSK6 Produits)

Synonymes: anticorps PACE4, anticorps PCSK6, anticorps SPC4, anticorps C86343, anticorps Pace4, anticorps Spc4, anticorps PACE4AIIa, anticorps Xpace4, anticorps spc4, anticorps proprotein convertase subtilisin/kexin type 6, anticorps peptidase S8, anticorps proprotein convertase subtilisin/kexin type 6 L homeolog, anticorps PCSK6, anticorps EAMY_RS27925, anticorps pcsk6, anticorps Pcsk6, anticorps pcsk6.L

Sujet: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: Paired basic amino acid cleaving enzyme 4 antibody|Paired basic amino acid cleaving system 4 antibody|PCSK6 antibody|PCSK6_HUMAN antibody|Proprotein convertase subtilisin/kexin type 6 antibody|SPC4 antibody|Subtilisin like protease antibody|Subtilisin-like proprotein convertase 4 antibody|subtilisin/kexin like protease PACE4 antibody|Subtilisin/kexin-like protease PACE4 antibody

ID gène: 5046

UniProt: P29122

Pathways: Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome