Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ABCB1 anticorps (Middle Region)

ABCB1 Reactivité: Humain, Souris, Rat IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043967
  • Antigène Voir toutes ABCB1 Anticorps
    ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
    Épitope
    • 6
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 621-650, Middle Region
    Reactivité
    • 67
    • 15
    • 11
    • 5
    • 5
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 43
    • 28
    Lapin
    Clonalité
    • 42
    • 29
    Polyclonal
    Conjugué
    • 44
    • 5
    • 4
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp ABCB1 est non-conjugé
    Application
    • 38
    • 24
    • 21
    • 20
    • 15
    • 12
    • 8
    • 8
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Fonction
    Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
    Séquence
    IYFKLVTMQT AGNEVELENA ADESKSEIDA
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
    Gene Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
    Protein Name: Multidrug resistance protein 1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product ABCB1 Anticorps primaire
  • Indications d'application
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    IHC-F: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by ABIN921231 in IHC(P) and IHC(F).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg Sodium azide.
    Agent conservateur
    Thimerosal (Merthiolate), Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Liu, Kuang, Wu, Jin, Sun: "A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." dans: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).

    Feng, Yan, Zhou, Liang, Liang, Zhao, Dong, Ling: "Piwil2 is reactivated by HPV oncoproteins and initiates cell reprogramming via epigenetic regulation during cervical cancer tumorigenesis." dans: Oncotarget, Vol. 7, Issue 40, pp. 64575-64588, (2018) (PubMed).

    Duan, Di: "Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 5818-5825, (2018) (PubMed).

    Liu, Wang, Kuang, Cao, Bao, Liu, Liu, Sun: "The natural compound GL22, isolated from Ganoderma mushrooms, suppresses tumor growth by altering lipid metabolism and triggering cell death." dans: Cell death & disease, Vol. 9, Issue 6, pp. 689, (2018) (PubMed).

    Deng, Li, Lin, Huang, Zeng, Wang, Li, Jin, Zhang, Li, Chen, Wang, Huang, Shao, Xu, Mao: "P-glycoprotein Mediates Postoperative Peritoneal Adhesion Formation by Enhancing Phosphorylation of the Chloride Channel-3." dans: Theranostics, Vol. 6, Issue 2, pp. 204-18, (2017) (PubMed).

    Ren, Qiu, Lü, Ru, Li, Xiang, Yu, Zhang: "TALENs-directed knockout of the full-length transcription factor Nrf1α that represses malignant behaviour of human hepatocellular carcinoma (HepG2) cells." dans: Scientific reports, Vol. 6, pp. 23775, (2017) (PubMed).

    Wang, Xi, Jiang, Ji, Yu, Zhu, Zhang: "Metronomic chemotherapy remodel cancer-associated fibroblasts to decrease chemoresistance of gastric cancer in nude mice." dans: Oncology letters, Vol. 14, Issue 6, pp. 7903-7909, (2017) (PubMed).

    Li, Tan, Chen, Xu, Yang, Ren, Guo, Wang, Chen, Li, Wang: "MDM4 overexpressed in acute myeloid leukemia patients with complex karyotype and wild-type TP53." dans: PLoS ONE, Vol. 9, Issue 11, pp. e113088, (2016) (PubMed).

    Wei, Wang, Yu, Ye, Jiang, Cheng: "Expression of TP53, BCL-2, and VEGFA Genes in Esophagus Carcinoma and its Biological Significance." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 21, pp. 3016-22, (2016) (PubMed).

    Han, Liu, Li, Tian, Han, Wang, Fu, Guo, Zhu, Du, Tian: "HOXB1 Is a Tumor Suppressor Gene Regulated by miR-3175 in Glioma." dans: PLoS ONE, Vol. 10, Issue 11, pp. e0142387, (2016) (PubMed).

    Zhang, Shang, Hao, Zheng, Li, Liang, Cui, Liu: "Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats." dans: American journal of translational research, Vol. 7, Issue 11, pp. 2176-86, (2016) (PubMed).

    Yin, Jiang, Peng, Cui, Zhou, He, Zuo, Ouyang, Fan, Fang: "The molecular mechanism of G2M cell cycle arrest induced by AFB1 in the jejunum." dans: Oncotarget, Vol. 7, Issue 24, pp. 35592-35606, (2016) (PubMed).

    Sasaki, Nitta, Sato, Nakanuma: "Autophagy may occur at an early stage of cholangiocarcinogenesis via biliary intraepithelial neoplasia." dans: Human pathology, Vol. 46, Issue 2, pp. 202-9, (2015) (PubMed).

    Liang, Peng, Li, Yang, Xie, Li, Du, Zhang: "Silencing of CXCR4 sensitizes triple-negative breast cancer cells to cisplatin." dans: Oncotarget, Vol. 6, Issue 2, pp. 1020-30, (2015) (PubMed).

    Luo, Zhou, Yi, Yi: "Lactotransferrin expression is downregulated and affects the mitogen-activated protein kinase pathway in gastric cancer." dans: Oncology letters, Vol. 9, Issue 5, pp. 2409-2413, (2015) (PubMed).

    Guo, Cui, Peng, Fang, Zuo, Deng, Wang, Wu, Chen, Deng: "Dietary NiCl₂ causes G₂/M cell cycle arrest in the broiler's kidney." dans: Oncotarget, Vol. 6, Issue 34, pp. 35964-77, (2015) (PubMed).

    Wang, Hou, Sun, Zhao, Tang, Hu, Yang, Zeng, Yang, Cui, Liu: "c-Ski activates cancer-associated fibroblasts to regulate breast cancer cell invasion." dans: Molecular oncology, Vol. 7, Issue 6, pp. 1116-28, (2014) (PubMed).

    Li, Wang, Li, Wang, Wang, Li, Han, Wang, Ma, Wang: "Proteomics analysis of normal and senescent NG108-15 cells: GRP78 plays a negative role in cisplatin-induced senescence in the NG108-15 cell line." dans: PLoS ONE, Vol. 9, Issue 3, pp. e90114, (2014) (PubMed).

    Lu, Luo, Wen: "Effect of ligustilide on Ang II-induced hypertrophy in cardiomyocytes and the potential mechanisms." dans: Experimental and therapeutic medicine, Vol. 8, Issue 1, pp. 169-174, (2014) (PubMed).

    Li, Wu, Wei, Wang, Sun, Li, Zhang, Zhang, Xin: "Anti-tumor effect of cactus polysaccharides on lung squamous carcinoma cells (SK-MES-1)." dans: African journal of traditional, complementary, and alternative medicines : AJTCAM / African Networks on Ethnomedicines, Vol. 11, Issue 5, pp. 99-104, (2014) (PubMed).

  • Antigène
    ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
    Autre désignation
    ABCB1 (ABCB1 Produits)
    Synonymes
    anticorps ABC20, anticorps CD243, anticorps CLCS, anticorps GP170, anticorps MDR1, anticorps P-GP, anticorps PGY1, anticorps Abcb1, anticorps Mdr1a, anticorps p-gp, anticorps xemdr, anticorps Mdr1, anticorps Mdr1b, anticorps Pgy-1, anticorps Pgy1, anticorps mdr, anticorps ABCB1, anticorps PGP1, anticorps ATP binding cassette subfamily B member 1, anticorps ATP binding cassette subfamily B member 1A, anticorps ATP binding cassette subfamily B member 1 L homeolog, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps ABCB1, anticorps Abcb1a, anticorps abcb1.L, anticorps Abcb1b, anticorps Abcb1
    Sujet
    P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

    Synonyms: ABC20 antibody|ABCB1 antibody|ATP binding cassette, sub family B (MDR/TAP), member 1 antibody|ATP-binding cassette sub-family B member 1 antibody|CD243 antibody|CLCS antibody|Colchicin sensitivity antibody|Doxorubicin resistance antibody|GP170 antibody|MDR1 antibody|MDR1_HUMAN antibody|Multidrug resistance 1 antibody|Multidrug resistance protein 1 antibody|P glycoprotein 1 antibody|P gp antibody|P-glycoprotein 1 antibody|PGY1 antibody
    ID gène
    5243
    UniProt
    P08183
Vous êtes ici:
Support technique