ARHGEF1 anticorps (N-Term)

N° du produit ABIN4886475

Détail du produit anti-ARHGEF1 anticorps

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Épitope: AA 41-71, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGEF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EQNSQFQSLE QVKRRPAHLM ALLQHVALQF E

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Rho guanine nucleotide exchange factor 1
Protein Name: Rho guanine nucleotide exchange factor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ARHGEF1

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Autre désignation: ARHGEF1 (ARHGEF1 Produits)

Synonymes: anticorps arhgef1, anticorps cb473, anticorps zgc:158261, anticorps ARHGEF1, anticorps GEF1, anticorps LBCL2, anticorps LSC, anticorps P115-RHOGEF, anticorps SUB1.5, anticorps Lbcl2, anticorps Lsc, anticorps Rho guanine nucleotide exchange factor (GEF) 1a, anticorps Rho guanine nucleotide exchange factor 1, anticorps Rho guanine nucleotide exchange factor (GEF) 1, anticorps arhgef1a, anticorps ARHGEF1, anticorps arhgef1, anticorps Arhgef1

Sujet: Rho guanine nucleotide exchange factor 1 is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Synonyms: ARHGEF 1 | ARHGEF1 | GEF 1 | GEF1 | LBCL 2 | LBCL2 | LSC | p115 RhoGEF | p115-RhoGEF | p115RhoGEF | Q92888

ID gène: 9138

UniProt: Q92888

Pathways: Neurotrophin Signaling Pathway, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling