Integrin Alpha2b anticorps
-
- Antigène Voir toutes Integrin Alpha2b (CD41) Anticorps
- Integrin Alpha2b (CD41)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Integrin Alpha2b est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- Amino acids EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN of human ITGA2B/CD41 were used as the immunogen for the CD41 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CD41 Anticorps primaire
-
anti-Integrin Alpha2b (CD41) (AA 45-149) antibody
CD41 Reactivité: Humain FACS, WB, ELISA, IHC Hôte: Souris Monoclonal 2E10C9 unconjugated
anti-Integrin Alpha2b (CD41) (AA 351-450) antibodyCD41 Reactivité: Humain, Rat FACS, WB, ELISA, IHC (fro), IHC (p), IF (p), IF (cc) Hôte: Lapin Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) (Internal Region) antibodyCD41 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivité: Souris FACS, ELISA, IHC (fro), IP, IHC (p), Func Hôte: Rat Monoclonal MWReg30 unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivité: Souris FACS, ELISA, IHC (fro), IP, IHC (p) Hôte: Rat Monoclonal MWReg30 unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivité: Humain, Non-Human Primate FACS, IHC (fro) Hôte: Souris Monoclonal HIP2 unconjugated
anti-Integrin Alpha2b (CD41) antibody (Biotin)CD41 Reactivité: Humain FACS Hôte: Souris Monoclonal MEM-06 Biotin
anti-Integrin Alpha2b (CD41) antibody (FITC)CD41 Reactivité: Humain FACS Hôte: Souris Monoclonal MEM-06 FITC
anti-Integrin Alpha2b (CD41) (AA 677-711), (C-Term) antibodyCD41 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivité: Humain, Non-Human Primate FACS, IHC (fro) Hôte: Souris Monoclonal HIP8 unconjugated
-
- Indications d'application
- Optimal dilution of the CD41 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the CD41 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Integrin Alpha2b (CD41)
- Autre désignation
- CD41 / ITGA2B (CD41 Produits)
- Synonymes
- anticorps AI172977, anticorps CD41, anticorps CD41B, anticorps GpIIb, anticorps alphaIIb, anticorps BDPLT16, anticorps BDPLT2, anticorps GP2B, anticorps GPIIb, anticorps GT, anticorps GTA, anticorps HPA3, anticorps integrin alpha 2b, anticorps integrin subunit alpha 2b, anticorps Itga2b, anticorps ITGA2B
- Sujet
- Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
- UniProt
- P08514
- Pathways
- Integrin Complex
-
