Gremlin 1 (GREM1) anticorps

Détails pour le produit réf. ABIN4951242
Antigène
  • grem1
  • MGC136702
  • zgc:136702
  • GREM1
  • drm
  • pig2
  • dand2
  • ihg-2
  • gremlin
  • Cktsf1b1
  • Drm
  • Grem
  • ld
  • gremlin-1
  • CKTSF1B1
  • DAND2
  • DRM
  • GREMLIN
  • IHG-2
  • cktsf1b1
  • gremlin 1a, DAN family BMP antagonist
  • gremlin 1, DAN family BMP antagonist
  • gremlin 1
  • gremlin 1, DAN family BMP antagonist L homeolog
  • grem1a
  • GREM1
  • LOC662541
  • grem1
  • Grem1
  • grem1.L
Reactivité
Humain, Rat (Rattus)
114
58
28
7
6
4
4
3
3
2
2
2
2
2
Hôte
Lapin
122
15
1
Clonalité
Polyclonal
Conjugué
Inconjugué
16
12
6
4
4
4
2
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
108
62
50
13
12
11
9
7
3
2
2
2
1
Options
Immunogène Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Gremlin 1 (GREM1 Antibody Extrait)
Sujet Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
UniProt O60565
Pathways Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location
Indications d'application Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Gremlin 1 (GREM1) antibody (ABIN4951242) Western blot testing of rat pancreas lysate with Gremlin 1 antibody. Expected/observe...
Avez-vous cherché autre chose?