GREM1 anticorps

N° du produit ABIN4951242

Détail du produit anti-GREM1 anticorps

Antigène: GREM1 (Gremlin 1 (GREM1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GREM1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GREM1

Antigène: GREM1 (Gremlin 1 (GREM1))

Autre désignation: Gremlin 1 (GREM1 Produits)

Synonymes: anticorps grem1, anticorps MGC136702, anticorps zgc:136702, anticorps GREM1, anticorps drm, anticorps pig2, anticorps dand2, anticorps ihg-2, anticorps gremlin, anticorps Cktsf1b1, anticorps Drm, anticorps Grem, anticorps ld, anticorps gremlin-1, anticorps CKTSF1B1, anticorps DAND2, anticorps DRM, anticorps GREMLIN, anticorps IHG-2, anticorps cktsf1b1, anticorps gremlin 1a, DAN family BMP antagonist, anticorps gremlin 1, DAN family BMP antagonist, anticorps gremlin 1, anticorps gremlin 1, DAN family BMP antagonist L homeolog, anticorps grem1a, anticorps GREM1, anticorps LOC662541, anticorps grem1, anticorps Grem1, anticorps grem1.L

Sujet: Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

UniProt: O60565

Pathways: Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location