ADRBK2 anticorps (Adrenergic, Beta, Receptor Kinase 2)

Details for Product anti-ADRBK2 Antibody No. ABIN4951248
Antigène
  • bark2
  • grk3
  • 4833444A01Rik
  • AI851927
  • AW551196
  • Adrbk-2
  • Bark-2
  • GRK3
  • BARK2
  • Grk3
  • si:dz221d18.1
  • G protein-coupled receptor kinase 3
  • GRK3
  • grk3
  • Grk3
Reactivité
Humain
108
60
41
8
3
2
2
2
2
1
1
1
1
1
Hôte
Lapin
107
1
Clonalité
Polyclonal
Conjugué
Cet anticorp ADRBK2 est non-conjugé
8
7
7
6
6
6
1
1
1
1
1
1
Application
Western Blotting (WB)
95
72
51
9
2
2
2
1
1
1
Options
Immunogène Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others ADRBK2 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation GRK3 / ADRBK2 (ADRBK2 Antibody Extrait)
Sujet Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
UniProt P35626
Pathways Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling
Indications d'application Optimal dilution of the GRK3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GRK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) antibody (ABIN4951248) Western blot testing of human Jurkat cell lysate with GRK3 antibody. Expected/observe...
Avez-vous cherché autre chose?