ADRBK2 anticorps

N° du produit ABIN4951248

Détail du produit anti-ADRBK2 anticorps

Antigène: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADRBK2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GRK3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GRK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ADRBK2

Antigène: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Autre désignation: GRK3 / ADRBK2 (ADRBK2 Produits)

Synonymes: anticorps bark2, anticorps grk3, anticorps 4833444A01Rik, anticorps AI851927, anticorps AW551196, anticorps Adrbk-2, anticorps Bark-2, anticorps GRK3, anticorps BARK2, anticorps Grk3, anticorps si:dz221d18.1, anticorps G protein-coupled receptor kinase 3, anticorps GRK3, anticorps grk3, anticorps Grk3

Sujet: Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.

UniProt: P35626

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling