IGFBP3 anticorps (Insulin-Like Growth Factor Binding Protein 3)

Details for Product anti-IGFBP3 Antibody No. ABIN4951427
Antigène
  • BP-53
  • IBP3
  • AI649005
  • IGFBP-3
  • IGgfbp3
  • IGF-BP3
  • zgc:91788
  • IGFBP3
  • igfbp3
  • insulin like growth factor binding protein 3
  • insulin-like growth factor binding protein 3
  • IGFBP3
  • Igfbp3
  • igfbp3
  • IGFBP-3
  • LOC100305016
Reactivité
Humain, Rat (Rattus)
194
88
58
11
10
5
4
3
3
2
2
2
2
1
1
Hôte
Lapin
203
24
7
3
Clonalité
Polyclonal
Conjugué
Cet anticorp IGFBP3 est non-conjugé
20
11
7
6
6
6
3
3
3
3
3
3
1
1
1
1
1
Application
ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
191
118
88
36
18
15
15
13
10
4
3
2
2
2
1
1
1
1
Options
Immunogène Amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGFBP3 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others IGFBP3 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation IGFBP3 (IGFBP3 Antibody Extrait)
Sujet IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
UniProt P17936
Pathways Myometrial Relaxation and Contraction, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Autophagy, Smooth Muscle Cell Migration, Growth Factor Binding
Indications d'application Optimal dilution of the IGFBP3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IGFBP3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Insulin-Like Growth Factor Binding Protein 3 (IGFBP3) antibody (ABIN4951427) Western blot testing of 1) rat kidney, 2) rat liver, 3) human SGC and 4) human 22RV1 ...
Avez-vous cherché autre chose?