Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4) anticorps

Détails pour le produit réf. ABIN4951575
Antigène
  • KV1.4
  • KCNA4
  • Kv1.4
  • DKFZp459N0126
  • KCHAN
  • Kv4
  • RHK1
  • RK3
  • HBK4
  • HK1
  • HPCN2
  • HUKII
  • KCNA4L
  • KCNA8
  • PCN2
  • potassium voltage-gated channel subfamily A member 4
  • potassium voltage-gated channel subfamily A member 4 S homeolog
  • potassium voltage-gated channel, shaker-related subfamily, member 4
  • KCNA4
  • LOC100622932
  • kcna4.S
  • Kcna4
Reactivité
Humain
62
43
32
3
1
1
Hôte
Lapin
64
11
Clonalité
Polyclonal
Conjugué
Inconjugué
5
4
4
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
56
22
13
10
8
3
2
1
1
1
1
1
Options
Immunogène Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Kv1.4 (KCNA4 Antibody Extrait)
Sujet Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]
UniProt P22459
Indications d'application Optimal dilution of the Kv1.4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4) antibody (ABIN4951575) Western blot testing of human 1) HeLa, 2) COLO320, 3) HT1080 and 4) PANC cell lysate ...
Avez-vous cherché autre chose?