LIMK2 anticorps (LIM Domain Kinase 2)

Details for Product anti-LIMK2 Antibody No. ABIN4951617
Antigène
  • xlimk2
  • zgc:91990
  • wu:fa97c09
  • wu:fk73e11
  • LIMK2
  • Limk2b
  • Link2
  • LIMK
  • 9430059K01
  • A930024P04Rik
  • C85310
  • Limk2a
  • LIM domain kinase 2 L homeolog
  • LIM domain kinase 2
  • LIM motif-containing protein kinase 2
  • limk2.L
  • limk2
  • LIMK2
  • Limk2
Reactivité
Humain, Souris
167
118
103
4
1
1
1
1
1
1
1
1
Hôte
Lapin
155
5
3
3
1
Clonalité
Polyclonal
Conjugué
Cet anticorp LIMK2 est non-conjugé
4
2
2
2
2
2
2
2
Application
Western Blotting (WB)
143
77
69
43
26
13
7
3
2
1
1
1
Options
Immunogène Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others LIMK2 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation LIM Kinase 2 / LIMK2 (LIMK2 Antibody Extrait)
Sujet LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.
UniProt P53671
Indications d'application Optimal dilution of the LIMK2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LIMK2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-LIM Domain Kinase 2 (LIMK2) antibody (ABIN4951617) Western blot testing of mouse 1) brain, 2) liver, 3) thymus, 4) testis, 5) human 293 ...
Avez-vous cherché autre chose?