LIMK2 anticorps

N° du produit ABIN4951617

Détail du produit anti-LIMK2 anticorps

Antigène: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIMK2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the LIMK2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the LIMK2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LIMK2

Antigène: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Autre désignation: LIM Kinase 2 / LIMK2 (LIMK2 Produits)

Synonymes: anticorps xlimk2, anticorps zgc:91990, anticorps wu:fa97c09, anticorps wu:fk73e11, anticorps LIMK2, anticorps Limk2b, anticorps Link2, anticorps LIMK, anticorps 9430059K01, anticorps A930024P04Rik, anticorps C85310, anticorps Limk2a, anticorps LIM domain kinase 2 L homeolog, anticorps LIM domain kinase 2, anticorps LIM motif-containing protein kinase 2, anticorps limk2.L, anticorps limk2, anticorps LIMK2, anticorps Limk2

Sujet: LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

UniProt: P53671