PCSK6 anticorps

N° du produit ABIN4952032

Détail du produit anti-PCSK6 anticorps

Antigène: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCSK6 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PACE4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PACE4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PCSK6

Antigène: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Autre désignation: PCSK6 / PACE4 (PCSK6 Produits)

Synonymes: anticorps PACE4, anticorps PCSK6, anticorps SPC4, anticorps C86343, anticorps Pace4, anticorps Spc4, anticorps PACE4AIIa, anticorps Xpace4, anticorps spc4, anticorps proprotein convertase subtilisin/kexin type 6, anticorps peptidase S8, anticorps proprotein convertase subtilisin/kexin type 6 L homeolog, anticorps PCSK6, anticorps EAMY_RS27925, anticorps pcsk6, anticorps Pcsk6, anticorps pcsk6.L

Sujet: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29122

Pathways: Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome