CXCR4 anticorps (C-Term)

N° du produit ABIN5518822

Détail du produit anti-CXCR4 anticorps

Antigène: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Épitope: AA 265-294, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXCR4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.

Séquence: ILLEIIKQGC EFENTVHKWI SITEALAFFH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.
Gene Name: chemokine (C-X-C motif) receptor 4
Protein Name: C-X-C chemokine receptor type 4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-CXCR4 (ABIN5518822)

Zhu, Sun, Tan, Xu, Dai, Wang, Fan, Zhou: "Tacrolimus promotes hepatocellular carcinoma and enhances CXCR4/SDF‑1α expression in vivo." dans: Molecular medicine reports, Vol. 10, Issue 2, pp. 585-92, (2015) (PubMed).

Zhang, Qi, Li, Zhang, Xu, Wang, Sun: "Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer." dans: Journal of experimental & clinical cancer research : CR, Vol. 27, pp. 62, (2009) (PubMed).

Détails sur CXCR4

Antigène: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Autre désignation: CXCR4 (CXCR4 Produits)

Synonymes: anticorps CD184, anticorps D2S201E, anticorps FB22, anticorps HM89, anticorps HSY3RR, anticorps LAP3, anticorps LCR1, anticorps LESTR, anticorps NPY3R, anticorps NPYR, anticorps NPYRL, anticorps NPYY3R, anticorps WHIM, anticorps Cmkar4, anticorps PB-CKR, anticorps PBSF/SDF-1, anticorps Sdf1r, anticorps CXC-R4-B, anticorps CXCR-4-B, anticorps cd184, anticorps cxcr4, anticorps fb22, anticorps hm89, anticorps hsy3rr, anticorps lap3, anticorps lcr1, anticorps lestr, anticorps npy3r, anticorps npyr, anticorps npyrl, anticorps npyy3r, anticorps xcxcr4, anticorps CXC-R4, anticorps CXCR-4, anticorps d2s201e, anticorps whim, anticorps CXC-R4-A, anticorps CXCR-4-A, anticorps xCXCR4, anticorps CXCR4, anticorps cb403, anticorps zgc:109863, anticorps cb824, anticorps C-X-C motif chemokine receptor 4, anticorps chemokine (C-X-C motif) receptor 4, anticorps C-X-C motif chemokine receptor 4 S homeolog, anticorps C-X-C chemokine receptor type 4, anticorps C-X-C motif chemokine receptor 4 L homeolog, anticorps chemokine (C-X-C motif), receptor 4b, anticorps chemokine (C-X-C motif) receptor 4a, anticorps CXCR4, anticorps Cxcr4, anticorps cxcr4.S, anticorps cxcr4, anticorps LOC100049444, anticorps cxcr4.L, anticorps cxcr4b, anticorps cxcr4a

Sujet: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Synonyms: C-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073

ID gène: 7852

UniProt: P61073

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events