CD47 anticorps
-
- Antigène Voir toutes CD47 Anticorps
- CD47
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD47 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.
- Séquence
- KSTVPTDFSS AKIEVSQLLK GDASLKMDKS DAVSHT
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.
Gene Name: CD47 Molecule
Protein Name: Leukocyte surface antigen CD47 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
- Isotype
- IgG
- Top Product
- Discover our top product CD47 Anticorps primaire
-
-
- Indications d'application
-
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- CD47
- Autre désignation
- CD47 (CD47 Produits)
- Synonymes
- anticorps IAP, anticorps MER6, anticorps OA3, anticorps 9130415E20Rik, anticorps AA407862, anticorps AI848868, anticorps AW108519, anticorps B430305P08Rik, anticorps Itgp, anticorps CD47/IAP, anticorps alkaline phosphatase, intestinal, anticorps CD47 molecule, anticorps CD47 antigen (Rh-related antigen, integrin-associated signal transducer), anticorps Cd47 molecule, anticorps ALPI, anticorps CD47, anticorps Cd47
- Sujet
-
CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Synonyms: Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, IAP, Protein MER6, CD47, CD47, MER6 - ID gène
- 961
- UniProt
- Q08722
-