CD47 anticorps

N° du produit ABIN5518975

Détail du produit anti-CD47 anticorps

Antigène: CD47

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD47 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.

Séquence: KSTVPTDFSS AKIEVSQLLK GDASLKMDKS DAVSHT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.
Gene Name: CD47 Molecule
Protein Name: Leukocyte surface antigen CD47

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CD47

Antigène: CD47

Autre désignation: CD47 (CD47 Produits)

Synonymes: anticorps IAP, anticorps MER6, anticorps OA3, anticorps 9130415E20Rik, anticorps AA407862, anticorps AI848868, anticorps AW108519, anticorps B430305P08Rik, anticorps Itgp, anticorps CD47/IAP, anticorps alkaline phosphatase, intestinal, anticorps CD47 molecule, anticorps CD47 antigen (Rh-related antigen, integrin-associated signal transducer), anticorps Cd47 molecule, anticorps ALPI, anticorps CD47, anticorps Cd47

Sujet: CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Synonyms: Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, IAP, Protein MER6, CD47, CD47, MER6

ID gène: 961

UniProt: Q08722