CDC20 anticorps

N° du produit ABIN5647763

Détail du produit anti-CDC20 anticorps

Antigène: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC20 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Cdc20 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Cdc20 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CDC20

Antigène: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Autre désignation: Cdc20 (CDC20 Produits)

Synonymes: anticorps X-FZY, anticorps ba276h19.3, anticorps cdc20a, anticorps fizzy1, anticorps p55cdc, anticorps CDC20A, anticorps bA276H19.3, anticorps p55CDC, anticorps 2310042N09Rik, anticorps C87100, anticorps cell division cycle 20, anticorps cell division cycle 20 L homeolog, anticorps cell division cycle 20 homolog (S. cerevisiae), anticorps cdc20, anticorps CDC20, anticorps cdc20.L, anticorps Cdc20

Sujet: The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

UniProt: Q12834