ABR anticorps

N° du produit ABIN5647965

Détail du produit anti-ABR anticorps

Antigène: ABR (Active BCR-Related (ABR))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the ABR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ABR

Antigène: ABR (Active BCR-Related (ABR))

Autre désignation: ABR / Active BCR related (ABR Produits)

Synonymes: anticorps MDB, anticorps xabr, anticorps 6330400K15Rik, anticorps AU042359, anticorps active BCR-related, anticorps active BCR-related L homeolog, anticorps active BCR-related gene, anticorps ABR, anticorps abr.L, anticorps Abr

Sujet: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

UniProt: Q12979

Pathways: Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity