PIAS3 anticorps

N° du produit ABIN5692909

Détail du produit anti-PIAS3 anticorps

Antigène: PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIAS3 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: QRFEEAHFTF ALTPQQVQQI LTSREVLPGA KCDYTIQVQL RF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for PIAS3 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human PIAS3 (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur PIAS3

Antigène: PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))

Autre désignation: PIAS3 (PIAS3 Produits)

Synonymes: anticorps PIAS3, anticorps Pias3l, anticorps ZMIZ5, anticorps protein inhibitor of activated STAT 3, anticorps protein inhibitor of activated STAT, 3, anticorps protein inhibitor of activated STAT 3 L homeolog, anticorps PIAS3, anticorps pias3, anticorps Pias3, anticorps pias3.L

Sujet:

Synonyms: E3 SUMO-protein ligase PIAS3, Protein inhibitor of activated STAT protein 3, PIAS3

Tissue Specificity: Widely expressed.

Background: E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.

UniProt: Q9Y6X2

Pathways: Signalistation JAK/STAT