ABCB1 anticorps
-
- Antigène Voir toutes ABCB1 Anticorps
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Séquence
- QAQDRKLSTK EALDESIPPV SFWRIMKLNL TEWPY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for P Glycoprotein detection. Tested with WB in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).
- Top Product
- Discover our top product ABCB1 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function." dans: Oncotarget, Vol. 7, Issue 8, pp. 9388-403, (2017) (PubMed).
: "
-
A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function." dans: Oncotarget, Vol. 7, Issue 8, pp. 9388-403, (2017) (PubMed).
-
- Antigène
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
- Autre désignation
- ABCB1 (ABCB1 Produits)
- Synonymes
- anticorps ABC20, anticorps CD243, anticorps CLCS, anticorps GP170, anticorps MDR1, anticorps P-GP, anticorps PGY1, anticorps Abcb1, anticorps Mdr1a, anticorps p-gp, anticorps xemdr, anticorps Mdr1, anticorps Mdr1b, anticorps Pgy-1, anticorps Pgy1, anticorps mdr, anticorps ABCB1, anticorps PGP1, anticorps ATP binding cassette subfamily B member 1, anticorps ATP binding cassette subfamily B member 1A, anticorps ATP binding cassette subfamily B member 1 L homeolog, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps ABCB1, anticorps Abcb1a, anticorps abcb1.L, anticorps Abcb1b, anticorps Abcb1
- Sujet
-
Synonyms: Multidrug resistance protein 1, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1
Tissue Specificity: Expressed in liver, kidney, small intestine and brain.
Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
- UniProt
- P08183
-