ERBB4 anticorps

N° du produit ABIN5693168

Détail du produit anti-ERBB4 anticorps

Antigène: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERBB4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: SLSDLEQQYR ALRKYYENCE VVMGNLEITS IEHNRDLSFL R

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ErbB 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human ErbB 4 (SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur ERBB4

Antigène: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Autre désignation: ERBB4 (ERBB4 Produits)

Synonymes: anticorps erbb4, anticorps si:ch211-227n20.1, anticorps Her4, anticorps c-erbB-4, anticorps HER4, anticorps p180erbB4, anticorps erb-b2 receptor tyrosine kinase 4, anticorps erb-b2 receptor tyrosine kinase 4a, anticorps v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian), anticorps erb-b2 receptor tyrosine kinase 4 L homeolog, anticorps receptor tyrosine-protein kinase ErbB-4, anticorps ERBB4, anticorps erbb4a, anticorps erbb4, anticorps erbb4.L, anticorps Tsp_13582, anticorps Erbb4

Sujet:

Synonyms: Receptor tyrosine-protein kinase erbB-4, Proto-oncogene-like protein c-ErbB-4, Tyrosine kinase-type cell surface receptor HER4, p180erbB4, ERBB4 intracellular domain, 4ICD, E4ICD, s80HER4, ERBB4, HER4

Tissue Specificity: Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are expressed in cerebellum, but only the isoform JM-B is expressed in the heart.

Background: ERBB4(V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.

UniProt: Q15303

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway