KDM2A anticorps

N° du produit ABIN5708449

Détail du produit anti-KDM2A anticorps

Antigène: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KDM2A est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Rat

Purification: Antigen affinity purified

Immunogène: Amino acids KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR from the human protein were used as the immunogen for the FBXL11 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FBXL11 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FBXL11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KDM2A

Antigène: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Autre désignation: KDM2A / FBXL11 (KDM2A Produits)

Synonymes: anticorps FBXL11, anticorps JHDM1A, anticorps 100043628, anticorps 5530401A10Rik, anticorps AA589516, anticorps AW536790, anticorps Cxxc8, anticorps Fbl11, anticorps Fbl7, anticorps Fbxl11, anticorps Gm4560, anticorps Jhdm1, anticorps Jhdm1a, anticorps lalina, anticorps KDM2A, anticorps CXXC8, anticorps FBL11, anticorps FBL7, anticorps LILINA, anticorps fb76b11, anticorps wu:fb76b11, anticorps wu:fj11c04, anticorps zgc:158441, anticorps zgc:158606, anticorps lysine demethylase 2A, anticorps lysine (K)-specific demethylase 2A, anticorps lysine (K)-specific demethylase 2Aa, anticorps KDM2A, anticorps Kdm2a, anticorps kdm2aa

Sujet: Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y2K7

Pathways: L'effet Warburg