NR1H2 anticorps (Middle Region)

N° du produit ABIN629580

Détail du produit anti-NR1H2 anticorps

Antigène: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR1H2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR1 H2 antibody was raised against the middle region of NR1 2

Purification: Purified

Immunogène: NR1 H2 antibody was raised using the middle region of NR1 2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR1H2 Blocking Peptide, catalog no. 33R-6119, is also available for use as a blocking control in assays to test for specificity of this NR1H2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR1H2

Antigène: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Autre désignation: NR1H2 (NR1H2 Produits)

Synonymes: anticorps NR1H2, anticorps lxr-b, anticorps lxrb, anticorps ner, anticorps ner-i, anticorps rip15, anticorps unr, anticorps DKFZp468A0622, anticorps AI194859, anticorps LXR, anticorps LXRB, anticorps LXRbeta, anticorps NER1, anticorps OR-1, anticorps RIP15, anticorps UR, anticorps Unr, anticorps Unr2, anticorps LXR-b, anticorps NER, anticorps NER-I, anticorps UNR, anticorps nuclear receptor subfamily 1 group H member 2, anticorps nuclear receptor subfamily 1, group H, member 2, anticorps nuclear receptor subfamily 1 group H member 2 L homeolog, anticorps NR1H2, anticorps nr1h2, anticorps Nr1h2, anticorps nr1h2.L

Sujet: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Nuclear Hormone Receptor Binding