RGS10 anticorps (Middle Region)

N° du produit ABIN629815

Détail du produit anti-RGS10 anticorps

Antigène: RGS10 (Regulator of G-Protein Signaling 10 (RGS10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS10 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS10 antibody was raised against the middle region of RGS10

Purification: Purified

Immunogène: RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS10 Blocking Peptide, catalog no. 33R-2132, is also available for use as a blocking control in assays to test for specificity of this RGS10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS10

Antigène: RGS10 (Regulator of G-Protein Signaling 10 (RGS10))

Autre désignation: RGS10 (RGS10 Produits)

Synonymes: anticorps MGC82511, anticorps RGS10, anticorps 2310010N19Rik, anticorps regulator of G-protein signaling 10, anticorps regulator of G-protein signaling 10 L homeolog, anticorps regulator of G protein signaling 10, anticorps regulator of G-protein signalling 10, anticorps RGS10, anticorps rgs10.L, anticorps rgs10, anticorps Rgs10

Sujet: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling