RGS10 anticorps (Middle Region)
-
- Antigène Voir toutes RGS10 Anticorps
- RGS10 (Regulator of G-Protein Signaling 10 (RGS10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RGS10 antibody was raised against the middle region of RGS10
- Purification
- Purified
- Immunogène
- RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
- Top Product
- Discover our top product RGS10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS10 Blocking Peptide, catalog no. 33R-2132, is also available for use as a blocking control in assays to test for specificity of this RGS10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS10 (Regulator of G-Protein Signaling 10 (RGS10))
- Autre désignation
- RGS10 (RGS10 Produits)
- Synonymes
- anticorps MGC82511, anticorps RGS10, anticorps 2310010N19Rik, anticorps regulator of G-protein signaling 10, anticorps regulator of G-protein signaling 10 L homeolog, anticorps regulator of G protein signaling 10, anticorps regulator of G-protein signalling 10, anticorps RGS10, anticorps rgs10.L, anticorps rgs10, anticorps Rgs10
- Sujet
- Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-