RELB anticorps (C-Term)

N° du produit ABIN629859

Cet anticorps anti-RELB Polyclonal Lapin (ABIN629859) détecte spécifiquement RELB dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour RELB anticorps (C-Term) (ABIN629859)

Antigène: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RELB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RELB anticorps

Épitope: C-Term

Specificité: RELB antibody was raised against the C terminal of RELB

Purification: Purified

Immunogène: RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RELB Blocking Peptide, (ABIN938855), is also available for use as a blocking control in assays to test for specificity of this RELB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RELB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RELB

Antigène: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Autre désignation: RELB

Sujet: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation RTK