RELB anticorps (C-Term)
-
- Antigène Voir toutes RELB Anticorps
- RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RELB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RELB antibody was raised against the C terminal of RELB
- Purification
- Purified
- Immunogène
- RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
- Top Product
- Discover our top product RELB Anticorps primaire
-
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (AA 1-579) antibody
RELB Reactivité: Humain WB, PLA Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (AA 1-579) antibodyRELB Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (C-Term) antibodyRELB Reactivité: Humain, Souris WB, IP, IHC (p), ChIP Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (pSer573) antibodyRELB Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (AA 248-492) antibodyRELB Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (AA 400-579) antibodyRELB Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (AA 161-260) antibodyRELB Reactivité: Humain, Souris WB, ELISA, IF (cc), IF (p), FACS, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) (pSer573) antibodyRELB Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) antibodyRELB Reactivité: Humain, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB) antibodyRELB Reactivité: Humain, Souris WB Hôte: Souris Monoclonal 4C5 unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RELB Blocking Peptide, catalog no. 33R-3469, is also available for use as a blocking control in assays to test for specificity of this RELB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RELB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))
- Autre désignation
- RELB (RELB Produits)
- Synonymes
- anticorps shep, anticorps I-REL, anticorps IREL, anticorps REL-B, anticorps XRelB, anticorps relb-A, anticorps GC-rich, anticorps avian reticuloendotheliosis viral (v-rel) oncogene related B, anticorps RELB proto-oncogene, NF-kB subunit, anticorps v-rel avian reticuloendotheliosis viral oncogene homolog B S homeolog, anticorps Relb, anticorps RELB, anticorps relb.S
- Sujet
- RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalisation RTK
-
