RRP9 anticorps (Middle Region)
-
- Antigène Voir toutes RRP9 Anticorps
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RRP9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RRP9 antibody was raised against the middle region of RRP9
- Purification
- Purified
- Immunogène
- RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
- Top Product
- Discover our top product RRP9 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RRP9 Blocking Peptide, catalog no. 33R-4097, is also available for use as a blocking control in assays to test for specificity of this RRP9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
- Autre désignation
- RRP9 (RRP9 Produits)
- Synonymes
- anticorps Rnu3ip2, anticorps RNU3IP2, anticorps U3-55K, anticorps 55kDa, anticorps D19435, anticorps D9Wsu10e, anticorps U3-55k, anticorps ribosomal RNA processing 9, U3 small nucleolar RNA binding protein, anticorps RRP9, small subunit (SSU) processome component, homolog (yeast), anticorps Rrp9, anticorps RRP9
- Sujet
- RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2
-