NUDT21 anticorps
-
- Antigène Voir toutes NUDT21 Anticorps
- NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUDT21 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
- Top Product
- Discover our top product NUDT21 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUDT21 Blocking Peptide, catalog no. 33R-9098, is also available for use as a blocking control in assays to test for specificity of this NUDT21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))
- Autre désignation
- NUDT21 (NUDT21 Produits)
- Synonymes
- anticorps CFIM25, anticorps CPSF5, anticorps 25kDa, anticorps 3110048P04Rik, anticorps 5730530J16Rik, anticorps AU014860, anticorps AW549947, anticorps Cpsf5, anticorps zgc:63966, anticorps cpsf5, anticorps An16g01870, anticorps AO090003001316, anticorps Afu5g02030, anticorps T9L24.30, anticorps T9L24_30, anticorps atnudt21, anticorps nudix hydrolase homolog 21, anticorps nudix hydrolase 21, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 21, anticorps nudix hydrolase 21 L homeolog, anticorps cleavage and polyadenylation specificity factor subunit 5, anticorps cleavage and polyadenylation specific factor 5, anticorps autocrine motility factor receptor, anticorps nudix hydrolase homolog 21, anticorps NUDT21, anticorps Nudt21, anticorps nudt21, anticorps nudt21.L, anticorps ANI_1_1518144, anticorps AOR_1_2312154, anticorps PTRG_11035, anticorps PAAG_04662, anticorps MCYG_02022, anticorps VDBG_06706, anticorps MGYG_04057, anticorps cpsf5, anticorps PGTG_05353, anticorps Tsp_03672, anticorps LOC732888, anticorps AFUA_5G02030, anticorps NFIA_040090, anticorps ACLA_003240, anticorps CC1G_07993, anticorps PMAA_039710, anticorps AFLA_025180, anticorps TSTA_079060, anticorps BDBG_01565, anticorps TERG_04393
- Sujet
- NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.
- Poids moléculaire
- 25 kDa (MW of target protein)
-