MCM5 anticorps (N-Term)

N° du produit ABIN630192

Détail du produit anti-MCM5 anticorps

Antigène: MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM5 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM5 antibody was raised against the N terminal of MCM5

Purification: Purified

Immunogène: MCM5 antibody was raised using the N terminal of MCM5 corresponding to a region with amino acids MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM5 Blocking Peptide, catalog no. 33R-6425, is also available for use as a blocking control in assays to test for specificity of this MCM5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM5

Antigène: MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))

Autre désignation: MCM5 (MCM5 Produits)

Synonymes: anticorps 23.m06024, anticorps cdc46, anticorps xmcm5, anticorps CDC46, anticorps P1-CDC46, anticorps Afu5g02520, anticorps NCU01171.1, anticorps AA617332, anticorps AI324988, anticorps AL033333, anticorps Cdc46, anticorps Mcmd5, anticorps mCD46, anticorps mCDC46, anticorps mcm5, anticorps wu:fb34a06, anticorps CG4082, anticorps DmCDC46, anticorps DmCDC465, anticorps DmMCM5, anticorps DmMcm5, anticorps DmeMCM5, anticorps Dmel\\CG4082, anticorps MCM5, anticorps McM5, anticorps PCR4, anticorps DNA replication licensing factor MCM5, anticorps minichromosome maintenance complex component 5 S homeolog, anticorps minichromosome maintenance complex component 5, anticorps DNA replication licensing factor Mcm5, anticorps DNA replication licensing factor mcm5, anticorps MCM5 minichromosome maintenance deficient 5 (S. cerevisiae), anticorps minichromosome maintenance complex component 5 L homeolog, anticorps Minichromosome maintenance 5, anticorps DNA replication licensing factor mcm-5, anticorps BBOV_IV010040, anticorps mcm5.S, anticorps MCM5, anticorps AFUA_5G02520, anticorps NCU01171, anticorps PVX_084615, anticorps LOC5576119, anticorps CpipJ_CPIJ008678, anticorps Bm1_24480, anticorps CMU_022890, anticorps Mcm5, anticorps mcm5, anticorps TP01_0722, anticorps mcm5.L, anticorps mcm-5

Sujet: The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA