SMPD2 anticorps
-
- Antigène Voir toutes SMPD2 Anticorps
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMPD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
- Top Product
- Discover our top product SMPD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMPD2 Blocking Peptide, catalog no. 33R-8123, is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
- Autre désignation
- SMPD2 (SMPD2 Produits)
- Synonymes
- anticorps SMPD2, anticorps NSMase, anticorps isc1, anticorps nsmase, anticorps nsmase1, anticorps AW108287, anticorps nSMase, anticorps nSMase1, anticorps ISC1, anticorps NSMASE, anticorps NSMASE1, anticorps sphingomyelin phosphodiesterase 2, anticorps sphingomyelin phosphodiesterase 2a, neutral membrane (neutral sphingomyelinase), anticorps sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase), anticorps sphingomyelin phosphodiesterase 2, neutral, anticorps SMPD2, anticorps smpd2a, anticorps smpd2, anticorps Smpd2
- Sujet
- SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-