KCNC1 anticorps (N-Term)

N° du produit ABIN630383

Détail du produit anti-KCNC1 anticorps

Antigène: KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNC1 antibody was raised against the N terminal of KCNC1

Purification: Purified

Immunogène: KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNC1 Blocking Peptide, catalog no. 33R-9400, is also available for use as a blocking control in assays to test for specificity of this KCNC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNC1

Antigène: KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))

Autre désignation: KCNC1 (KCNC1 Produits)

Synonymes: anticorps kv3.1, anticorps C230009H10Rik, anticorps KShIIIB, anticorps KV4, anticorps Kcr2-1, anticorps Kv3.1, anticorps NGK2, anticorps Shaw, anticorps Kv4, anticorps NGK2-KV4, anticorps KV3.1, anticorps KCNC2, anticorps zgc:194940, anticorps zgc:194950, anticorps potassium voltage-gated channel subfamily C member 1, anticorps potassium voltage-gated channel, Shaw-related subfamily, member 1, anticorps potassium voltage gated channel, Shaw-related subfamily, member 1, anticorps potassium voltage-gated channel, Shaw-related subfamily, member 1a, anticorps KCNC1, anticorps kcnc1, anticorps Kcnc1, anticorps kcnc1a

Sujet: KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Poids moléculaire: 58 kDa (MW of target protein)