SLC6A8 anticorps
-
- Antigène Voir toutes SLC6A8 Anticorps
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC6A8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
- Top Product
- Discover our top product SLC6A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC6A8 Blocking Peptide, catalog no. 33R-1670, is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
- Autre désignation
- SLC6A8 (SLC6A8 Produits)
- Synonymes
- anticorps SLC6A8, anticorps chot1, anticorps crtr, anticorps creaT, anticorps CHOT1, anticorps CHT1, anticorps CRT, anticorps CT1, anticorps AA589632, anticorps CRTR, anticorps Creat, anticorps CCDS1, anticorps solute carrier family 6 member 8, anticorps sodium- and chloride-dependent creatine transporter 1, anticorps solute carrier family 6 (neurotransmitter transporter), member 8, anticorps solute carrier family 6 (neurotransmitter transporter, creatine), member 8, anticorps SLC6A8, anticorps LOC473853, anticorps slc6a8, anticorps LOC100440816, anticorps Slc6a8
- Sujet
- SLC6A8 is required for the uptake of creatine in muscles and brain.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response
-