NR4A1 anticorps (Middle Region)

N° du produit ABIN630504

Détail du produit anti-NR4A1 anticorps

Antigène: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR4A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR4 A1 antibody was raised against the middle region of NR4 1

Purification: Affinity purified

Immunogène: NR4 A1 antibody was raised using the middle region of NR4 1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR4A1 Blocking Peptide, catalog no. 33R-3032, is also available for use as a blocking control in assays to test for specificity of this NR4A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR4A1

Antigène: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Autre désignation: NR4A1 (NR4A1 Produits)

Synonymes: anticorps GFRP1, anticorps HMR, anticorps N10, anticorps NAK-1, anticorps NGFIB, anticorps NP10, anticorps NUR77, anticorps TR3, anticorps NGFI-B, anticorps Gfrp, anticorps Hbr-1, anticorps Hbr1, anticorps Hmr, anticorps TIS1, anticorps nur77, anticorps Ngfi-b, anticorps Nur77, anticorps nuclear receptor subfamily 4 group A member 1, anticorps nuclear receptor subfamily 4, group A, member 1, anticorps NR4A1, anticorps Nr4a1

Sujet: NR4A1 encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Steroid Hormone Mediated Signaling Pathway