Lamin B1 anticorps (Middle Region)

N° du produit ABIN630637

Détail du produit anti-Lamin B1 anticorps

Antigène: Lamin B1 (LMNB1)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lamin B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Lamin B1 antibody was raised against the middle region of LMNB1

Purification: Affinity purified

Immunogène: Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lamin B1 Blocking Peptide, catalog no. 33R-2393, is also available for use as a blocking control in assays to test for specificity of this Lamin B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lamin B1

Antigène: Lamin B1 (LMNB1)

Autre désignation: Lamin B1 (LMNB1 Produits)

Synonymes: anticorps MGC52550, anticorps Lamin-L(I), anticorps lamin-b, anticorps lmn, anticorps lmn2, anticorps lmnb, anticorps LMNB1, anticorps ADLD, anticorps LMN, anticorps LMN2, anticorps LMNB, anticorps fc06g01, anticorps wu:fc06g01, anticorps lamin B1 L homeolog, anticorps lamin B1, anticorps lmnb1.L, anticorps lmnb1, anticorps LMNB1, anticorps Lmnb1

Sujet: LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Apoptose, Caspase Cascade in Apoptosis