ERCC4 anticorps (Middle Region)
-
- Antigène Voir toutes ERCC4 Anticorps
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERCC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ERCC4 antibody was raised against the middle region of Ercc4
- Purification
- Affinity purified
- Immunogène
- ERCC4 antibody was raised using the middle region of Ercc4 corresponding to a region with amino acids FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
- Top Product
- Discover our top product ERCC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERCC4 Blocking Peptide, catalog no. 33R-2974, is also available for use as a blocking control in assays to test for specificity of this ERCC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
- Autre désignation
- ERCC4 (ERCC4 Produits)
- Synonymes
- anticorps ERCC11, anticorps FANCQ, anticorps RAD1, anticorps XPF, anticorps AI606920, anticorps Xpf, anticorps RGD1560340, anticorps fi03a05, anticorps zgc:63468, anticorps wu:fi03a05, anticorps ercc11, anticorps rad1, anticorps xpf, anticorps ERCC4, anticorps LOC100231158, anticorps ERCC excision repair 4, endonuclease catalytic subunit, anticorps excision repair cross-complementing rodent repair deficiency, complementation group 4, anticorps excision repair cross-complementation group 4, anticorps excision repair cross-complementation group 4 L homeolog, anticorps ERCC4, anticorps Ercc4, anticorps ercc4, anticorps ercc4.L, anticorps XPF
- Sujet
- The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1.
- Poids moléculaire
- 101 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-