LAT2 anticorps (N-Term)

N° du produit ABIN630764

Détail du produit anti-LAT2 anticorps

Antigène: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Épitope: N-Term

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: LAB antibody was raised against the N terminal Of Lab

Purification: Affinity purified

Immunogène: LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAT2

Antigène: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Autre désignation: LAB (LAT2 Produits)

Synonymes: anticorps LAB, anticorps NTAL, anticorps WBSCR15, anticorps WBSCR5, anticorps WSCR5, anticorps LAT2, anticorps MGC139435, anticorps Ntal, anticorps Wbscr5, anticorps AW125574, anticorps Wbscr15, anticorps linker for activation of T-cells family member 2, anticorps linker for activation of T cells family, member 2, anticorps LAT2, anticorps Lat2

Sujet: Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, BCR Signaling