AKTIP anticorps (Middle Region)

N° du produit ABIN630793

Détail du produit anti-AKTIP anticorps

Antigène: AKTIP (AKT Interacting Protein (AKTIP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKTIP est non-conjugé

Application: Western Blotting (WB)

Specificité: AKTIP antibody was raised against the middle region of AKTIP

Purification: Affinity purified

Immunogène: AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKTIP Blocking Peptide, catalog no. 33R-6833, is also available for use as a blocking control in assays to test for specificity of this AKTIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKTIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKTIP

Antigène: AKTIP (AKT Interacting Protein (AKTIP))

Autre désignation: AKTIP (AKTIP Produits)

Synonymes: anticorps FT1, anticorps FTS, anticorps cb798, anticorps fts, anticorps zgc:77699, anticorps fts-A, anticorps aktip, anticorps fts-B, anticorps MGC133931, anticorps AL023020, anticorps Fif, anticorps Ft, anticorps Ft1, anticorps Fts, anticorps AKT interacting protein, anticorps akt interacting protein, anticorps AKT interacting protein L homeolog, anticorps AKT interacting protein S homeolog, anticorps thymoma viral proto-oncogene 1 interacting protein, anticorps AKTIP, anticorps aktip, anticorps aktip.L, anticorps aktip.S, anticorps Aktip

Sujet: AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.

Poids moléculaire: 33 kDa (MW of target protein)