RCHY1 anticorps (N-Term)
-
- Antigène Voir toutes RCHY1 Anticorps
- RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RCHY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RCHY1 antibody was raised against the N terminal of RCHY1
- Purification
- Affinity purified
- Immunogène
- RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY
- Top Product
- Discover our top product RCHY1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RCHY1 Blocking Peptide, catalog no. 33R-4551, is also available for use as a blocking control in assays to test for specificity of this RCHY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCHY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))
- Autre désignation
- RCHY1 (RCHY1 Produits)
- Synonymes
- anticorps ARNIP, anticorps CHIMP, anticorps PIRH2, anticorps PRO1996, anticorps RNF199, anticorps ZNF363, anticorps Pirh2, anticorps Zfp363, anticorps Znf363, anticorps wu:fb37e07, anticorps zgc:101128, anticorps RCHY1, anticorps arnip, anticorps chimp, anticorps pirh2, anticorps harnip, anticorps rnf199, anticorps znf363, anticorps pro1996, anticorps ring finger and CHY zinc finger domain containing 1, anticorps ring finger and CHY zinc finger domain containing 1 L homeolog, anticorps RCHY1, anticorps Rchy1, anticorps rchy1, anticorps rchy1.L
- Sujet
- RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.
- Poids moléculaire
- 23 kDa (MW of target protein)
-