PIWIL2 anticorps
-
- Antigène Voir toutes PIWIL2 Anticorps
- PIWIL2 (Piwi-Like 2 (PIWIL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIWIL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
- Top Product
- Discover our top product PIWIL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIWIL2 (Piwi-Like 2 (PIWIL2))
- Autre désignation
- PIWIL2 (PIWIL2 Produits)
- Synonymes
- anticorps si:dkey-88f5.1, anticorps zili, anticorps Piwil1l, anticorps mili, anticorps CT80, anticorps HILI, anticorps PIWIL1L, anticorps piwil2, anticorps piwi like RNA-mediated gene silencing 2, anticorps piwi-like RNA-mediated gene silencing 2, anticorps piwil2, anticorps Piwil2, anticorps PIWIL2
- Sujet
- PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
- Poids moléculaire
- 110 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-