PIWIL2 anticorps

N° du produit ABIN630850

Détail du produit anti-PIWIL2 anticorps

Antigène: PIWIL2 (Piwi-Like 2 (PIWIL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIWIL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIWIL2

Antigène: PIWIL2 (Piwi-Like 2 (PIWIL2))

Autre désignation: PIWIL2 (PIWIL2 Produits)

Synonymes: anticorps si:dkey-88f5.1, anticorps zili, anticorps Piwil1l, anticorps mili, anticorps CT80, anticorps HILI, anticorps PIWIL1L, anticorps piwil2, anticorps piwi like RNA-mediated gene silencing 2, anticorps piwi-like RNA-mediated gene silencing 2, anticorps piwil2, anticorps Piwil2, anticorps PIWIL2

Sujet: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Stem Cell Maintenance