VPS4A anticorps

N° du produit ABIN630949

Détail du produit anti-VPS4A anticorps

Antigène: VPS4A (Vacuolar Protein Sorting-Associated Protein 4A (VPS4A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS4A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS4A Blocking Peptide, catalog no. 33R-10096, is also available for use as a blocking control in assays to test for specificity of this VPS4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS4A

Antigène: VPS4A (Vacuolar Protein Sorting-Associated Protein 4A (VPS4A))

Autre désignation: VPS4A (VPS4A Produits)

Synonymes: anticorps vsp4, anticorps SKD1, anticorps SKD1A, anticorps SKD2, anticorps VPS4, anticorps VPS4-1, anticorps zgc:153907, anticorps 4930589C15Rik, anticorps AI325971, anticorps AW553189, anticorps vacuolar protein sorting 4 homolog A, anticorps vacuolar sorting protein 4, anticorps vacuolar protein sorting 4 homolog A L homeolog, anticorps vacuolar protein sorting 4a homolog A (S. cerevisiae), anticorps vacuolar protein sorting 4A, anticorps VPS4A, anticorps TP03_0351, anticorps vps4a, anticorps vps4a.L, anticorps Vps4a

Sujet: VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, CXCR4-mediated Signaling Events