DBNL anticorps (Middle Region)
-
- Antigène Voir toutes DBNL Anticorps
- DBNL (Drebrin-Like (DBNL))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DBNL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DBNL antibody was raised against the middle region of DBNL
- Purification
- Affinity purified
- Immunogène
- DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
- Top Product
- Discover our top product DBNL Anticorps primaire
-
anti-Drebrin-Like (DBNL) (N-Term) antibody
DBNL Reactivité: Humain WB, IF, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (N-Term) antibodyVerified DBNL Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (AA 201-300) antibodyDBNL Reactivité: Souris WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Hôte: Lapin Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (AA 251-300) antibodyDBNL Reactivité: Humain, Souris, Cobaye, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DBNL Blocking Peptide, catalog no. 33R-7539, is also available for use as a blocking control in assays to test for specificity of this DBNL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBNL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DBNL (Drebrin-Like (DBNL))
- Autre désignation
- DBNL (DBNL Produits)
- Synonymes
- anticorps ABP1, anticorps HIP-55, anticorps HIP55, anticorps SH3P7, anticorps Abp1, anticorps mAbp1, anticorps Sh3p7, anticorps abp1, anticorps dbnl-B, anticorps DBNL, anticorps DKFZp459C0939, anticorps drebrin like, anticorps drebrin-like, anticorps drebrin like S homeolog, anticorps drebrin 1, anticorps DBNL, anticorps Dbnl, anticorps dbnl.S, anticorps LOC100148204, anticorps DBN1
- Sujet
- DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- TCR Signaling, Regulation of Actin Filament Polymerization
-
