IDH1 anticorps
-
- Antigène Voir toutes IDH1 Anticorps
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IDH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
- Top Product
- Discover our top product IDH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IDH1 Blocking Peptide, catalog no. 33R-9808, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
- Autre désignation
- IDH1 (IDH1 Produits)
- Synonymes
- anticorps IDCD, anticorps IDH, anticorps IDP, anticorps IDPC, anticorps PICD, anticorps NADP-CICDH, anticorps AI314845, anticorps AI788952, anticorps E030024J03Rik, anticorps Id-1, anticorps Idh-1, anticorps Idpc, anticorps cb876, anticorps fm90e09, anticorps im:7143416, anticorps wu:fm90e09, anticorps F23E12.180, anticorps F23E12_180, anticorps IDH-I, anticorps NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1, anticorps isocitrate dehydrogenase 1, anticorps isocitrate dehydrogenase I, anticorps isocitrate dehydrogenase (NADP(+)) 1, cytosolic, anticorps isocitrate dehydrogenase 1 (NADP+), soluble, anticorps isocitrate dehydrogenase 1 (NADP+) L homeolog, anticorps isocitrate dehydrogenase 1, anticorps IDH1, anticorps Idh1, anticorps idh1.L, anticorps idh1
- Sujet
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- L'effet Warburg
-