IDH1 anticorps

N° du produit ABIN631068

Cet anticorps anti-IDH1 Polyclonal Lapin (ABIN631068) détecte spécifiquement IDH1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour IDH1 anticorps (ABIN631068)

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IDH1 anticorps

Purification: Affinity purified

Immunogène: IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IDH1 Blocking Peptide, (ABIN5614132), is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IDH1

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Autre désignation: IDH1

Sujet: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: L'effet Warburg