HPD anticorps (Middle Region)

N° du produit ABIN631126

Cet anticorps Lapin Polyclonal détecte spécifiquement HPD dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HPD anticorps (Middle Region) (ABIN631126)

Antigène: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HPD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HPD anticorps

Épitope: Middle Region

Specificité: HPD antibody was raised against the middle region of HPD

Purification: Affinity purified

Immunogène: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HPD Blocking Peptide, (ABIN937970), is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HPD

Antigène: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Autre désignation: HPD

Sujet: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Poids moléculaire: 45 kDa (MW of target protein)