HPD anticorps (Middle Region)
-
- Antigène Voir toutes HPD Anticorps
- HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HPD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HPD antibody was raised against the middle region of HPD
- Purification
- Affinity purified
- Immunogène
- HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV
- Top Product
- Discover our top product HPD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HPD Blocking Peptide, catalog no. 33R-2584, is also available for use as a blocking control in assays to test for specificity of this HPD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))
- Autre désignation
- HPD (HPD Produits)
- Synonymes
- anticorps fb58f02, anticorps hpd, anticorps wu:fb58f02, anticorps zgc:56326, anticorps zgc:92456, anticorps MGC146689, anticorps BA0240, anticorps PSPTO3553, anticorps DDBDRAFT_0203373, anticorps DDBDRAFT_0231603, anticorps DDBDRAFT_0231604, anticorps DDB_0203373, anticorps DDB_0231603, anticorps DDB_0231604, anticorps hppd, anticorps 4-HPPD, anticorps 4HPPD, anticorps GLOD3, anticorps HPPDASE, anticorps PPD, anticorps 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE, anticorps F12K11.9, anticorps F12K11_9, anticorps HPD, anticorps P-HYDROXYPHENYLPYRUVATE DIOXYGENASE, anticorps phytoene desaturation 1, anticorps Fla, anticorps Flp, anticorps Hppd, anticorps Laf, anticorps 4-hydroxyphenylpyruvate dioxygenase a, anticorps 4-hydroxyphenylpyruvate dioxygenase, anticorps 4-hydroxyphenylpyruvate dioxygenase b, anticorps 4-hydroxyphenylpyruvate dioxygenase L homeolog, anticorps 4-hydroxyphenylpyruvic acid dioxygenase, anticorps hpda, anticorps HPD, anticorps hpdb, anticorps hpd.L, anticorps hpd, anticorps BA_0240, anticorps hppD, anticorps Hpd, anticorps PDS1
- Sujet
- The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.
- Poids moléculaire
- 45 kDa (MW of target protein)
-