HPD anticorps (Middle Region)

N° du produit ABIN631126

Détail du produit anti-HPD anticorps

Antigène: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HPD est non-conjugé

Application: Western Blotting (WB)

Specificité: HPD antibody was raised against the middle region of HPD

Purification: Affinity purified

Immunogène: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HPD Blocking Peptide, catalog no. 33R-2584, is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HPD

Antigène: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Autre désignation: HPD (HPD Produits)

Synonymes: anticorps fb58f02, anticorps hpd, anticorps wu:fb58f02, anticorps zgc:56326, anticorps zgc:92456, anticorps MGC146689, anticorps BA0240, anticorps PSPTO3553, anticorps DDBDRAFT_0203373, anticorps DDBDRAFT_0231603, anticorps DDBDRAFT_0231604, anticorps DDB_0203373, anticorps DDB_0231603, anticorps DDB_0231604, anticorps hppd, anticorps 4-HPPD, anticorps 4HPPD, anticorps GLOD3, anticorps HPPDASE, anticorps PPD, anticorps 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE, anticorps F12K11.9, anticorps F12K11_9, anticorps HPD, anticorps P-HYDROXYPHENYLPYRUVATE DIOXYGENASE, anticorps phytoene desaturation 1, anticorps Fla, anticorps Flp, anticorps Hppd, anticorps Laf, anticorps 4-hydroxyphenylpyruvate dioxygenase a, anticorps 4-hydroxyphenylpyruvate dioxygenase, anticorps 4-hydroxyphenylpyruvate dioxygenase b, anticorps 4-hydroxyphenylpyruvate dioxygenase L homeolog, anticorps 4-hydroxyphenylpyruvic acid dioxygenase, anticorps hpda, anticorps HPD, anticorps hpdb, anticorps hpd.L, anticorps hpd, anticorps BA_0240, anticorps hppD, anticorps Hpd, anticorps PDS1

Sujet: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Poids moléculaire: 45 kDa (MW of target protein)