Diazepam Binding Inhibitor anticorps

N° du produit ABIN631130

Détail du produit anti-Diazepam Binding Inhibitor anticorps

Antigène: Diazepam Binding Inhibitor (DBI)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Diazepam Binding Inhibitor est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DBI Blocking Peptide, catalog no. 33R-6477, is also available for use as a blocking control in assays to test for specificity of this DBI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Diazepam Binding Inhibitor

Antigène: Diazepam Binding Inhibitor (DBI)

Autre désignation: DBI (DBI Produits)

Synonymes: anticorps ACBD1, anticorps ACBP, anticorps CCK-RP, anticorps EP, anticorps dbib, anticorps DBI, anticorps wu:fb63e10, anticorps zgc:56108, anticorps zgc:77734, anticorps Acbp, anticorps endozepine, anticorps Acoabp3, anticorps Ep, anticorps Odn, anticorps RNACOABP3, anticorps Ttn, anticorps acbd1, anticorps acbp, anticorps cck-rp, anticorps dbi, anticorps dbi-a, anticorps dbi-b, anticorps dbia, anticorps diazepam binding inhibitor, acyl-CoA binding protein, anticorps diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) S homeolog, anticorps diazepam-binding inhibitor, anticorps diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), anticorps acyl-CoA-binding protein, anticorps diazepam binding inhibitor, anticorps diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) L homeolog, anticorps DBI, anticorps dbi.S, anticorps dbi, anticorps LOC706367, anticorps Dbi, anticorps dbi.L

Sujet: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis.

Poids moléculaire: 10 kDa (MW of target protein)