PRKAR1B anticorps (Middle Region)
-
- Antigène Voir toutes PRKAR1B Anticorps
- PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKAR1B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKAR1 B antibody was raised against the middle region of PRKAR1
- Purification
- Affinity purified
- Immunogène
- PRKAR1 B antibody was raised using the middle region of PRKAR1 corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
- Top Product
- Discover our top product PRKAR1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKAR1B Blocking Peptide, catalog no. 33R-5240, is also available for use as a blocking control in assays to test for specificity of this PRKAR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))
- Autre désignation
- PRKAR1B (PRKAR1B Produits)
- Synonymes
- anticorps PRKAR1B, anticorps AI385716, anticorps RIbeta, anticorps RGD1563094, anticorps PRKAR1, anticorps zgc:153624, anticorps prkar1, anticorps protein kinase cAMP-dependent type I regulatory subunit beta, anticorps protein kinase, cAMP dependent regulatory, type I beta, anticorps protein kinase cAMP-dependent type 1 regulatory subunit beta, anticorps protein kinase, cAMP-dependent, regulatory, type I, beta, anticorps protein kinase, cAMP-dependent, regulatory subunit type I beta S homeolog, anticorps PRKAR1B, anticorps prkar1b, anticorps Prkar1b, anticorps prkar1b.S
- Sujet
- Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
-