GSTM5 anticorps (N-Term)

N° du produit ABIN631425

Détail du produit anti-GSTM5 anticorps

Antigène: GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTM5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTM5 antibody was raised against the N terminal of GSTM5

Purification: Affinity purified

Immunogène: GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTM5 Blocking Peptide, catalog no. 33R-6298, is also available for use as a blocking control in assays to test for specificity of this GSTM5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTM5

Antigène: GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))

Autre désignation: GSTM5 (GSTM5 Produits)

Synonymes: anticorps GSTM5-5, anticorps GTM5, anticorps glutathione S-transferase mu 5, anticorps glutathione S-transferase, mu 5, anticorps GSTM5, anticorps Gstm5

Sujet: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Poids moléculaire: 26 kDa (MW of target protein)